| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50289552 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_201293 |
|---|
| IC50 | 1±n/a nM |
|---|
| Citation |  Mantegani, S; Brambilla, E; Cremonesi, P; Caccia, C; Fornaretto, MG; Carfagna, N; Colombo, M; McArthur, RA; Varasi, M (E) and (Z)-3-Styrylpiperidines as sigma ligands Bioorg Med Chem Lett7:1525-1530 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50289552 |
|---|
| n/a |
|---|
| Name | BDBM50289552 |
|---|
| Synonyms: | 1-(3-Methyl-but-2-enyl)-3-((Z)-styryl)-piperidine | CHEMBL40031 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H25N |
|---|
| Mol. Mass. | 255.3978 |
|---|
| SMILES | [#6]\[#6](-[#6])=[#6]/[#6]-[#7]-1-[#6]-[#6]-[#6]-[#6](-[#6]-1)\[#6]=[#6]/c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
