new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM50289581
Substrate/Competitorn/a
Meas. Tech.ChEBML_210656
Ki 4.8±n/a nM
Citation Quan MLWityak JDominguez CDuncia JVKettner CAEllis CDLiauw AYPark JMSantella JBKnabb RMThoolen MJWeber PCWexler RR Biaryl substituted alkylboronate esters as thrombin inhibitors Bioorg Med Chem Lett 7:1595-1600 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50289581
n/a
NameBDBM50289581
Synonyms:2-Nitro-biphenyl-4-carboxylic acid [(R)-4-guanidino-1-((2S,6R)-2,9,9-trimethyl-3,5-dioxa-4-bora-tricyclo[6.1.1.0*2,6*]dec-4-yl)-butyl]-amide | CHEMBL263204
TypeSmall organic molecule
Emp. Form.C28H36BN5O5
Mol. Mass.533.427
SMILESCC1(C)C2CC1C1(C)OB(OC1C2)C(CCC[N-]C(N)=[NH2+])NC(=O)c1ccc(-c2ccccc2)c(c1)[N+]([O-])=O |THB:8:6:1:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: