| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50289585 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_210656 |
|---|
| Ki | 13±n/a nM |
|---|
| Citation |  Quan, ML; Wityak, J; Dominguez, C; Duncia, JV; Kettner, CA; Ellis, CD; Liauw, AY; Park, JM; Santella, JB; Knabb, RM; Thoolen, MJ; Weber, PC; Wexler, RR Biaryl substituted alkylboronate esters as thrombin inhibitors Bioorg Med Chem Lett7:1595-1600 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM50289585 |
|---|
| n/a |
|---|
| Name | BDBM50289585 |
|---|
| Synonyms: | (3-{5-[(R)-4-Guanidino-1-((2S,6R)-2,9,9-trimethyl-3,5-dioxa-4-bora-tricyclo[6.1.1.0*2,6*]dec-4-yl)-butylcarbamoyl]-thiophen-2-yl}-phenyl)-carbamic acid tert-butyl ester | CHEMBL276881 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H44BN5O5S |
|---|
| Mol. Mass. | 609.588 |
|---|
| SMILES | CC(C)(C)OC(=O)Nc1cccc(c1)-c1ccc(s1)C(=O)N[C@@H](CCCNC(N)=N)B1O[C@@H]2CC3CC(C3(C)C)[C@]2(C)O1 |TLB:42:40:37:35| |
|---|
| Structure | 
|
|---|
Search and Browse
