Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50290093 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_201429 |
---|
Ki | 2.9±n/a nM |
---|
Citation | Yamashita, A; Takahashi, N; Mochizuki, D; Tsujita, R; Yamada, S; Kawakubo, H; Suzuki, Y; Watanabe, H An aromatic moiety is not essential for pharmacophore binding to sigma binding sites: Synthesis of N-alkylazacycloheptane derivatives as potent sigma ligands Bioorg Med Chem Lett7:2303-2306 (1997) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50290093 |
---|
n/a |
---|
Name | BDBM50290093 |
Synonyms: | (S)-3-(2-Cyclooctyl-ethyl)-1,8,8-trimethyl-3-aza-bicyclo[3.2.1]octane | CHEMBL307839 |
Type | Small organic molecule |
Emp. Form. | C20H37N |
Mol. Mass. | 291.5145 |
SMILES | CC1(C)C2CC[C@]1(C)CN(CCC1CCCCCCC1)C2 |THB:10:9:1:5.4| |
Structure |
|