new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor gamma/retinoic acid receptor alpha
LigandBDBM31883
Substrate/Competitorn/a
Meas. Tech.ChEBML_195161
Ki 0.100000±n/a nM
Citation Wong MFRepa JJClagett-Dame MCurley RW Synthesis and receptor binding affinity of conformationally restricted retinoic acid analogues Bioorg Med Chem Lett 7:2313-2318 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor gamma/retinoic acid receptor alpha
Name:Retinoic acid receptor alpha/Retinoid X receptor alpha
Synonyms:Nuclear receptor subfamily 1 group B member 1 | RAR-alpha | Retinoic acid receptor alpha
Type:PROTEIN
Mol. Mass.:50778.87
Organism:Homo sapiens (Human)
Description:ChEMBL_1466191
Residue:462
Sequence:
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31883
n/a
NameBDBM31883
Synonyms:9-cis-retinoic acid (9cRA) | ALL-TRANS-RETINOIC ACID | AT-RA | Atralin | CHEMBL38 | MLS000028588 | SMR000058245 | TRETINOIN | Vitamin A acid | [3H]RA | [3H]Retinoic acid | [3H]Vitamin A acid | [3H]tretinoin | all-trans retinoic acid | cid_444795
Typeradiolabeled ligand
Emp. Form.C20H28O2
Mol. Mass.300.4351
SMILESC\C(\C=C\C1=C(C)CCCC1(C)C)=C/C=C/C(/C)=C/C(O)=O |c:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: