new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor gamma/retinoic acid receptor alpha
LigandBDBM50290137
Substrate/Competitorn/a
Meas. Tech.ChEBML_197244
Ki>7200±n/a nM
Citation Wong MFRepa JJClagett-Dame MCurley RW Synthesis and receptor binding affinity of conformationally restricted retinoic acid analogues Bioorg Med Chem Lett 7:2313-2318 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor gamma/retinoic acid receptor alpha
Name:Retinoid X receptor gamma/retinoic acid receptor alpha
Synonyms:Nuclear receptor subfamily 2 group B member 3 | Retinoic acid receptor RXR-gamma | Retinoid X receptor gamma
Type:PROTEIN
Mol. Mass.:50878.26
Organism:Homo sapiens (Human)
Description:ChEMBL_197216
Residue:463
Sequence:
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290137
n/a
NameBDBM50290137
Synonyms:(2E,4E)-3-Methyl-5-{2-[(E)-2-(3,3,6,6-tetramethyl-cyclohex-1-enyl)-vinyl]-cyclopropyl}-penta-2,4-dienoic acid | CHEMBL74331
TypeSmall organic molecule
Emp. Form.C21H30O2
Mol. Mass.314.4617
SMILESC\C(\C=C\C1CC1\C=C\C1=CC(C)(C)CCC1(C)C)=C/C(O)=O |t:10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: