new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProgesterone receptor
LigandBDBM50290364
Substrate/Competitorn/a
Meas. Tech.ChEBML_159701
IC50 3±n/a nM
Citation Connolly PJWetter SKBeers KNHamel SCHaynes-Johnson DKiddoe MKraft PLai MTCampen CPalmer SPhillips A Synthesis and progesterone receptor binding affinity of substituted 1-phenyl-7-benzyl-4,5,6,7-tetrahydro-1H-indazoles Bioorg Med Chem Lett 7:2551-2556 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Progesterone receptor
Name:Progesterone receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:98665.51
Organism:Oryctolagus cuniculus
Description:ChEMBL_775980
Residue:930
Sequence:
MTELKAKEPRAPHVAGGAPSPTEVGSQLLGRPDPGPFQGSQTSEASSVVSAIPISLDGLL
FPRPCQGQNPPDGKTQDPPSLSDVEGAFPGVEAPEGAGDSSSRPPEKDSGLLDSVLDTLL
APSGPGQSHASPATCEAISPWCLFGPDLPEDPRAAPATKGVLAPLMSRPEDKAGDSSGTA
AAHKVLPRGLSPSRQLLLPSSGSPHWPAVKPSPQPAAVQVDEEDSSESEGTVGPLLKGQP
RALGGTAAGGGAAPVASGAAAGGVALVPKEDSRFSAPRVSLAEQDAPVAPGRSPLATSVV
DFIHVPILPLNHAFLATRTRQLLEGESYDGGAAAASPFVPQRGSPSASSTPVAGGDFPDC
TYPPDAEPKDDAFPLYGDFQPPALKIKEEEEAAEAAARSPRTYLVAGANPAAFPDFQLAA
PPPPSLPPRVPSSRPGEAAVAASPGSASVSSSSSSGSTLECILYKAEGAPPQQGPFAPLP
CKPPGAGACLLPRDGLPSTSASGAAAGAAPALYPTLGLNGLPQLGYQAAVLKEGLPQVYT
PYLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQH
NYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALDAVALPQP
VGIPNESQRITFSPSQEIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGE
RQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLI
LNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQSQFEE
MRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSV
EFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290364
n/a
NameBDBM50290364
Synonyms:7-Benzyl-1-(4-fluoro-phenyl)-4,5,6,7-tetrahydro-1H-indazole-3-carbaldehyde | CHEMBL315989
TypeSmall organic molecule
Emp. Form.C21H19FN2O
Mol. Mass.334.3868
SMILESFc1ccc(cc1)-n1nc(C=O)c2CCCC(Cc3ccccc3)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: