new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic acid receptor RXR-alpha
LigandBDBM50032675
Substrate/Competitorn/a
Meas. Tech.ChEBML_196497
EC50 33±n/a nM
Citation Farmer LJZhi LJeong SKallel EACroston GFlatten KSHeyman RANadzan AM Synthesis and structure-activity relationships of potent conformationally restricted retinoid X receptor ligands Bioorg Med Chem Lett 7:2747-2752 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Retinoic acid receptor RXR-alpha
Name:Nuclear receptor subfamily 4 group A member 2/Retinoic acid receptor RXR-alpha
Synonyms:Nuclear receptor subfamily 2 group B member 1 | Nuclear receptor subfamily 4 group A member 2 | Retinoid X receptor alpha | Retinoid receptor
Type:PROTEIN
Mol. Mass.:50820.38
Organism:Homo sapiens (Human)
Description:ChEMBL_1456363
Residue:462
Sequence:
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032675
n/a
NameBDBM50032675
Synonyms:4-[1-(3,5,5,8,8-pentamethyl-5,6,7,8-tetrahydronaphthalen-2-yl)vinyl]benzoic acid | BEXAROTENE | CHEMBL1023 | p-(1-(5,6,7,8-Tetrahydro-3,5,5,8,8-pentamethyl-2-naphthyl)vinyl)benzoic acid
TypeSmall organic molecule
Emp. Form.C24H28O2
Mol. Mass.348.4779
SMILESCc1cc2c(cc1C(=C)c1ccc(cc1)C(O)=O)C(C)(C)CCC2(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: