new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurokinin 1 receptor
LigandBDBM50290859
Substrate/Competitorn/a
Meas. Tech.ChEBML_143042
IC50 0.160000±n/a nM
Citation Swain CJWilliams BJBaker RCascieri MAChicchi GForrest MHerbert RKeown LLadduwahetty TLuell SMacIntyre DEMetzger JMorton SOwens APSadowski SWatt AP 3-Benzyloxy-2-phenylpiperidine NK1 antagonists: the influence of alpha methyl substitution Bioorg Med Chem Lett 7:2959-2962 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Neurokinin 1 receptor
Name:Neurokinin 1 receptor
Synonyms:NK-1 receptor | NK-1R | NK1 Receptor | Neurokinin NK1 | SPR | Substance-P receptor | TACR1 | Tachykinin receptor 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46371.54
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were carried out using membrane preparations from transfected CHO cells that constitutively expressed the rat NK1 receptor.
Residue:407
Sequence:
MDNVLPMDSDLFPNISTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAH
KRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHVFFLLPYINPDLYLKKFIQQVYLASMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYKVSRLETTIST
VVGAHEEEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290859
n/a
NameBDBM50290859
Synonyms:5-{3-[1-(3,5-Bis-trifluoromethyl-phenyl)-ethoxy]-2-phenyl-piperidin-1-ylmethyl}-2,4-dihydro-[1,2,4]triazol-3-one | CHEMBL98524
TypeSmall organic molecule
Emp. Form.C24H24F6N4O2
Mol. Mass.514.4634
SMILESC[C@@H](O[C@H]1CCCN(Cc2n[nH]c(=O)[nH]2)[C@H]1c1ccccc1)c1cc(cc(c1)C(F)(F)F)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: