new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C delta type
LigandBDBM50290874
Substrate/Competitorn/a
Meas. Tech.ChEBML_160790
Ki 6500±n/a nM
Citation Endo YHirano MDriedger PEStabel SShudo K Novel conformationally constrained analogues of diacylglycerol. Protein kinase C binding affinity of simplified compounds based on a 6-membered lactam moiety Bioorg Med Chem Lett 7:2997-3000 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C delta type
Name:Protein kinase C, PKC; classical/novel
Synonyms:PKC delta | Protein Kinase C- delta | nPKC-delta
Type:Enzyme
Mol. Mass.:77516.79
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:676
Sequence:
MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
RSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290874
n/a
NameBDBM50290874
Synonyms:(3R,6S)-6-Hydroxymethyl-3-isopropyl-4-tetradecyl-piperazin-2-one | CHEMBL103658
TypeSmall organic molecule
Emp. Form.C22H44N2O2
Mol. Mass.368.597
SMILESCCCCCCCCCCCCCCN1C[C@@H](CO)NC(=O)[C@H]1C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: