new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNociceptin/mu opioid receptor
LigandBDBM50290967
Substrate/Competitorn/a
Meas. Tech.ChEBML_138995
Ki 87±n/a nM
Citation Sabin VHorwell DCMcKnight ATBroqua P trans N-Methyl-N-[2-(1-pyrrolidinyl)cyclohexyl] cycloprop-2-ene-1-carboxamides: Novel lipophilic kappa opioid agonists Bioorg Med Chem Lett 7:291-296 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Nociceptin/mu opioid receptor
Name:Nociceptin/mu opioid receptor
Synonyms:MOR-1 | MUOR1 | Mu-type opioid receptor | Mu-type opioid receptor (MOR) | OPIATE Mu | Opiate non-selective | Opioid receptor B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44503.11
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor.
Residue:398
Sequence:
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290967
n/a
NameBDBM50290967
Synonyms:1-{(5R,7S,8S)-8-[(2-Benzofuran-4-yl-acetyl)-methyl-amino]-1-oxa-spiro[4.5]dec-7-yl}-pyrrolidinium | 2-Benzofuran-4-yl-N-methyl-N-((5R,7S,8S)-7-pyrrolidin-1-yl-1-oxa-spiro[4.5]dec-8-yl)-acetamide | CHEMBL318859 | CI-977
TypeSmall organic molecule
Emp. Form.C24H32N2O3
Mol. Mass.396.5225
SMILESCN([C@H]1CC[C@@]2(CCCO2)C[C@@H]1N1CCCC1)C(=O)Cc1cccc2occc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: