new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50291052
Substrate/Competitorn/a
Meas. Tech.ChEBML_157558
Ki 3.1±n/a nM
Citation Schwartz TMBundy GLStrohbach JWThaisrivongs SJohnson PDSkulnick HITomich PKLynn JCChong KTHinshaw RRRaub TJPadbury GEToth LN Synthesis and pharmacological evaluation of sulfone substituted HIV protease inhibitors Bioorg Med Chem Lett 7:399-402 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50291052
n/a
NameBDBM50291052
Synonyms:6-(2-Cyclopropyl-1-cyclopropylmethyl-ethyl)-3-{cyclopropyl-[3-(1-methyl-1H-imidazole-2-sulfonylmethyl)-phenyl]-methyl}-4-hydroxy-pyran-2-one | CHEMBL340638
TypeSmall organic molecule
Emp. Form.C29H34N2O5S
Mol. Mass.522.656
SMILESCn1ccnc1S(=O)(=O)Cc1cccc(c1)C(C1CC1)c1c(O)cc(oc1=O)C(CC1CC1)CC1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: