Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArachidonate 15-lipoxygenase
LigandBDBM50135851
Substrate/Competitorn/a
Meas. Tech.ChEMBL_546738
IC50 1300±n/a nM
Citation Fu XSchmitz FJGovindan MAbbas SAHanson KMHorton PACrews PLaney MSchatzman RC Enzyme Inhibitors: New and Known Polybrominated Phenols and Diphenyl Ethers from Four Indo-Pacific Dysidea Sponges J Nat Prod 58:1384-1391 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arachidonate 15-lipoxygenase
Name:Arachidonate 15-lipoxygenase
Synonyms:15-Lipoxygenase-1 (15-LOX-1) | Arachidonate 15-lipoxygenase-1 | Reticulocyte 15-lipoxygenase-1
Type:Protein
Mol. Mass.:74804.05
Organism:Homo sapiens (Human)
Description:n/a
Residue:662
Sequence:
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPL
LFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP
QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK
GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV
LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL
VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH
LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS
LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH
ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ
PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV
AI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50135851
n/a
NameBDBM50135851
Synonyms:2,3,4,5-tetrabromo-6-(3,5-dibromo-2-hydroxy-phenoxy)-phenol | 2,3,4,5-tetrabromo-6-(3,5-dibromo-2-hydroxyphenoxy)phenol | CHEMBL150098
TypeSmall organic molecule
Emp. Form.C12H4Br6O3
Mol. Mass.675.582
SMILESOc1c(Br)cc(Br)cc1Oc1c(O)c(Br)c(Br)c(Br)c1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: