Reaction Details |
| Report a problem with these data |
Target | Ribonuclease pancreatic |
---|
Ligand | BDBM50292713 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_493881 (CHEMBL944252) |
---|
Ki | 27±n/a nM |
---|
Citation | Samanta, A; Leonidas, DD; Dasgupta, S; Pathak, T; Zographos, SE; Oikonomakos, NG Morpholino, piperidino, and pyrrolidino derivatives of pyrimidine nucleosides as inhibitors of ribonuclease A: synthesis, biochemical, and crystallographic evaluation. J Med Chem52:932-42 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ribonuclease pancreatic |
---|
Name: | Ribonuclease pancreatic |
Synonyms: | RIB1 | RNAS1_HUMAN | RNASE1 | RNAse A | RNS1 | Ribonuclease A | Ribonuclease pancreatic |
Type: | Protein |
Mol. Mass.: | 17653.66 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 156 |
Sequence: | MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
|
|
|
BDBM50292713 |
---|
n/a |
---|
Name | BDBM50292713 |
Synonyms: | 5'-phospho-2'-deoxyuridine 3-pyrophosphate (P'->5') adenosine 3'-phosphate | CHEMBL455775 |
Type | Small organic molecule |
Emp. Form. | C19H25N7O14P2 |
Mol. Mass. | 637.3878 |
SMILES | Nc1ncnc2n(cnc12)[C@@H]1O[C@H](CO)[C@@H](OP(O)(=O)OP(O)(=O)OC[C@H]2O[C@H](C[C@@H]2O)n2ccc(=O)[nH]c2=O)[C@H]1O |r| |
Structure |
|