| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribonuclease pancreatic |
|---|
| Ligand | BDBM50292720 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_493877 (CHEMBL944248) |
|---|
| Ki | 179000±n/a nM |
|---|
| Citation |  Samanta, A; Leonidas, DD; Dasgupta, S; Pathak, T; Zographos, SE; Oikonomakos, NG Morpholino, piperidino, and pyrrolidino derivatives of pyrimidine nucleosides as inhibitors of ribonuclease A: synthesis, biochemical, and crystallographic evaluation. J Med Chem52:932-42 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ribonuclease pancreatic |
|---|
| Name: | Ribonuclease pancreatic |
|---|
| Synonyms: | CAM-RNase A | RNAS1_BOVIN | RNASE1 | RNAse A | RNS1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 16468.79 |
|---|
| Organism: | Bison bison (American bison) |
|---|
| Description: | carboxamidomethylated RNase A |
|---|
| Residue: | 150 |
|---|
| Sequence: | MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRN
LTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPN
CAYKTTQANKHIIVACEGNPYVPVHFDASV
|
|
|
|---|
| BDBM50292720 |
|---|
| n/a |
|---|
| Name | BDBM50292720 |
|---|
| Synonyms: | 5'-deoxy-5'-N-morpholinouridine | CHEMBL460902 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H19N3O6 |
|---|
| Mol. Mass. | 313.3065 |
|---|
| SMILES | O[C@@H]1[C@@H](CN2CCOCC2)O[C@H]([C@@H]1O)n1ccc(=O)[nH]c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
