Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLuciferin 4-monooxygenase
LigandBDBM50129791
Substrate/Competitorn/a
Meas. Tech.ChEMBL_514920
IC50 200±n/a nM
Citation Auld DSZhang YQSouthall NTRai GLandsman MMacLure JLangevin DThomas CJAustin CPInglese J A basis for reduced chemical library inhibition of firefly luciferase obtained from directed evolution. J Med Chem 52:1450-8 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Luciferin 4-monooxygenase
Name:Luciferin 4-monooxygenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:60747.46
Organism:Photinus pyralis
Description:ChEMBL_938513
Residue:550
Sequence:
MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAHIEVNITYAEYFEMS
VRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMNI
SQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSHLPPGFNEYD
FVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIIPDTAILSV
VPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTL
IDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPG
AVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHS
GDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGEL
PAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGKLDARKIREILI
KAKKGGKSKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50129791
n/a
NameBDBM50129791
Synonyms:(4-Benzothiazol-2-yl-phenyl)-dimethyl-amine | 4-(Benzo[d]thiazol-2-yl)-N,N-dimethylaniline | CHEMBL92816
TypeSmall organic molecule
Emp. Form.C15H14N2S
Mol. Mass.254.35
SMILESCN(C)c1ccc(cc1)-c1nc2ccccc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: