Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLuciferin 4-monooxygenase
LigandBDBM50293106
Substrate/Competitorn/a
Meas. Tech.ChEMBL_514920
IC50 600±n/a nM
Citation Auld DSZhang YQSouthall NTRai GLandsman MMacLure JLangevin DThomas CJAustin CPInglese J A basis for reduced chemical library inhibition of firefly luciferase obtained from directed evolution. J Med Chem 52:1450-8 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Luciferin 4-monooxygenase
Name:Luciferin 4-monooxygenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:60747.46
Organism:Photinus pyralis
Description:ChEMBL_938513
Residue:550
Sequence:
MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAHIEVNITYAEYFEMS
VRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMNI
SQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSHLPPGFNEYD
FVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIIPDTAILSV
VPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTL
IDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPG
AVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHS
GDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGEL
PAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGKLDARKIREILI
KAKKGGKSKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50293106
n/a
NameBDBM50293106
Synonyms:2-(2-Fluorophenyl)-6-methoxybenzo[d]thiazole | CHEMBL508666
TypeSmall organic molecule
Emp. Form.C14H10FNOS
Mol. Mass.259.299
SMILESCOc1ccc2nc(sc2c1)-c1ccccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: