Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent dopamine transporter
LigandBDBM50048392
Substrate/Competitorn/a
Meas. Tech.ChEMBL_571435
Ki 441±n/a nM
Citation Lapinsky DJAggarwal SHuang YSurratt CKLever JRFoster JDVaughan RA A novel photoaffinity ligand for the dopamine transporter based on pyrovalerone. Bioorg Med Chem 17:3770-4 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium-dependent dopamine transporter
Name:Monoamine transporter
Synonyms:DA transporter | DAT | DAT1 | Dopamine transporter (DAT) | Dopamine transporter protein (DAT) | SLC6A3 | Sodium-dependent dopamine transporter (DAT) | Solute carrier family 6 member 3
Type:Multi-pass membrane protein
Mol. Mass.:68497.11
Organism:Homo sapiens (Human)
Description:Q01959
Residue:620
Sequence:
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048392
n/a
NameBDBM50048392
Synonyms:2-(tert-butylamino)-1-(3-chlorophenyl)propan-1-one | BUPROPION | BUPROPION HYDROCHLORIDE | CHEMBL894 | US9944618, Compound ID No. 176
TypeSmall organic molecule
Emp. Form.C13H18ClNO
Mol. Mass.239.741
SMILESCC(NC(C)(C)C)C(=O)c1cccc(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: