Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Aurora-C
LigandBDBM50277585
Substrate/Competitorn/a
Meas. Tech.ChEMBL_571641
Ki 11±n/a nM
Citation Bebbington DBinch HCharrier JDEveritt SFraysse DGolec JKay DKnegtel RMak CMazzei FMiller AMortimore MO'Donnell MPatel SPierard FPinder JPollard JRamaya SRobinson DRutherford AStudley JWestcott J The discovery of the potent aurora inhibitor MK-0457 (VX-680). Bioorg Med Chem Lett 19:3586-92 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Aurora-C
Name:Serine/threonine-protein kinase Aurora-C
Synonyms:Aurora kinase C | Aurora kinase C (AURKC) | Aurora-C | Aurora/Ipl1-related kinase 3 | Aurora/Ipl1/Eg2 protein 2 | Serine/threonine-protein kinase 13
Type:Enzyme
Mol. Mass.:35602.43
Organism:Homo sapiens (Human)
Description:Amino acid residues 1-309 were expressed as His-tagged fusion protein using baculovirus expression system.
Residue:309
Sequence:
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLA
RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
LPPCAQMAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277585
n/a
NameBDBM50277585
Synonyms:CHEMBL484950 | N-(4-(4-(3-methyl-1H-pyrazol-5-ylamino)quinazolin-2-ylthio)phenyl)acetamide | N-(4-(4-(5-methyl-1H-pyrazol-3-ylamino)quinazolin-2-ylthio)phenyl)acetamide
TypeSmall organic molecule
Emp. Form.C20H18N6OS
Mol. Mass.390.462
SMILESCC(=O)Nc1ccc(Sc2nc(Nc3cc(C)n[nH]3)c3ccccc3n2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: