Reaction Details |
| Report a problem with these data |
Target | Hypoxanthine-guanine phosphoribosyltransferase |
---|
Ligand | BDBM50293832 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_572371 (CHEMBL1035272) |
---|
pH | 7.4±n/a |
---|
Ki | >300000±n/a nM |
---|
Comments | extracted |
---|
Citation | Keough, DT; Hocková, D; Holý, A; Naesens, LM; Skinner-Adams, TS; Jersey, J; Guddat, LW Inhibition of hypoxanthine-guanine phosphoribosyltransferase by acyclic nucleoside phosphonates: a new class of antimalarial therapeutics. J Med Chem52:4391-9 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hypoxanthine-guanine phosphoribosyltransferase |
---|
Name: | Hypoxanthine-guanine phosphoribosyltransferase |
Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
Type: | Protein |
Mol. Mass.: | 24579.61 |
Organism: | Homo sapiens (Human) |
Description: | P00492 |
Residue: | 218 |
Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
BDBM50293832 |
---|
n/a |
---|
Name | BDBM50293832 |
Synonyms: | ((S)-1-(2-amino-8-bromo-6-oxo-1,6,7,8-tetrahydropurin-9-yl)propan-2-yloxy)methylphosphonate | CHEMBL555285 |
Type | Small organic molecule |
Emp. Form. | C9H15BrN5O5P |
Mol. Mass. | 384.124 |
SMILES | C[C@@H](CN1C(Br)Nc2c1nc(N)[nH]c2=O)OCP(O)(O)=O |r| |
Structure |
|