| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Corticotropin-releasing factor receptor 1 |
|---|
| Ligand | BDBM50293986 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_572726 (CHEMBL1030150) |
|---|
| IC50 | 1.2±n/a nM |
|---|
| Citation |  Hartz, RA; Ahuja, VT; Arvanitis, AG; Rafalski, M; Yue, EW; Denhart, DJ; Schmitz, WD; Ditta, JL; Deskus, JA; Brenner, AB; Hobbs, FW; Payne, J; Lelas, S; Li, YW; Molski, TF; Mattson, GK; Peng, Y; Wong, H; Grace, JE; Lentz, KA; Qian-Cutrone, J; Zhuo, X; Shu, YZ; Lodge, NJ; Zaczek, R; Combs, AP; Olson, RE; Bronson, JJ; Mattson, RJ; Macor, JE Synthesis, structure-activity relationships, and in vivo evaluation of N3-phenylpyrazinones as novel corticotropin-releasing factor-1 (CRF1) receptor antagonists. J Med Chem52:4173-91 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Corticotropin-releasing factor receptor 1 |
|---|
| Name: | Corticotropin-releasing factor receptor 1 |
|---|
| Synonyms: | CRF-R | CRF1 | CRFR1_RAT | CRH-R 1 | Corticotropin releasing factor receptor | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1 | Crhr | Crhr1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 47870.75 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Receptor binding assays were performed using rat cortex homogenate. |
|---|
| Residue: | 415 |
|---|
| Sequence: | MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
|
|
|
|---|
| BDBM50293986 |
|---|
| n/a |
|---|
| Name | BDBM50293986 |
|---|
| Synonyms: | (R)-5-Bromo-1-(1-cyclopropylethyl)-3-[6-methoxy-2-(trifluoromethyl)pyridin-3-ylamino]pyrazin-2(1H)-one | CHEMBL556462 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H16BrF3N4O2 |
|---|
| Mol. Mass. | 433.223 |
|---|
| SMILES | COc1ccc(Nc2nc(Br)cn([C@H](C)C3CC3)c2=O)c(n1)C(F)(F)F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
