Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPolyamine oxidase
LigandBDBM50294110
Substrate/Competitorn/a
Meas. Tech.ChEMBL_570655
pH6.5±n/a
Ki 1.7±n/a nM
Commentsextracted
Citation Manetti FCona AAngeli LMugnaini CRaffi FCapone CDreassi EZizzari ATTisi AFederico RBotta M Synthesis and biological evaluation of guanidino compounds endowed with subnanomolar affinity as competitive inhibitors of maize polyamine oxidase. J Med Chem 52:4774-85 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Polyamine oxidase
Name:Polyamine oxidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:56339.65
Organism:Zea mays
Description:ChEMBL_570655
Residue:500
Sequence:
MSSSPSFGLLAVAALLLALSLAQHGSLAATVGPRVIVVGAGMSGISAAKRLSEAGITDLL
ILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYL
AQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPN
GPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYL
AGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQ
SDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVW
QEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPR
WWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAE
ILINCAQKKMCKYHVQGKYD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50294110
n/a
NameBDBM50294110
Synonyms:1,1'-(8,8'-azanediylbis(octane-8,1-diyl))bis(3-(3-methylbut-2-enyl)guanidine) | 1,17-Bis(N1-gamma.gamma-dimethylallyl)guanidino-9-azaheptadecano tris(trifluoroacetate) | CHEMBL560899
TypeSmall organic molecule
Emp. Form.C28H57N7
Mol. Mass.491.7991
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-[#7]-[#6](-[#7])=[#7]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#7]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#7]-[#6](-[#7])=[#7]-[#6]\[#6]=[#6](\[#6])-[#6] |w:29.29,8.8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: