Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H3 receptor
LigandBDBM22911
Substrate/Competitorn/a
Meas. Tech.ChEMBL_577510
Ki 2±n/a nM
Citation Mitobe YIto SMizutani TNagase TSato NTokita S Development of a selective and potent radioactive ligand for histamine H(3) receptors: A compound potentially useful for receptor occupancy studies. Bioorg Med Chem Lett 19:4075-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H3 receptor
Name:Histamine H3 receptor
Synonyms:HH3R
Type:PROTEIN
Mol. Mass.:48560.37
Organism:Mus musculus
Description:ChEMBL_988451
Residue:445
Sequence:
MERAPPDGLMNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVETGEAGLGGGSGGGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHGSLEQCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22911
n/a
NameBDBM22911
Synonyms:2-(3H-imidazol-4-yl)ethylsulfanylmethanimidamide | CHEMBL19439 | CHEMBL544911 | Imetit | {[2-(1H-imidazol-4-yl)ethyl]sulfanyl}methanimidamide
TypeSmall organic molecule
Emp. Form.C6H10N4S
Mol. Mass.170.235
SMILESNC(=N)SCCc1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: