| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50295351 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_578404 (CHEMBL1058744) |
|---|
| IC50 | >33000±n/a nM |
|---|
| Citation |  Corbel, C; Haddoub, R; Guiffant, D; Lozach, O; Gueyrard, D; Lemoine, J; Ratin, M; Meijer, L; Bach, S; Goekjian, P Identification of potential cellular targets of aloisine A by affinity chromatography. Bioorg Med Chem17:5572-82 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC28 | CDK1 | CDK1_YEAST | Cell division control protein 28 | HSL5 | SRM5 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 34067.63 |
|---|
| Organism: | Saccharomyces cerevisiae |
|---|
| Description: | ChEMBL_563811 |
|---|
| Residue: | 298 |
|---|
| Sequence: | MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS
LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQL
CKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP
EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV
YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES
|
|
|
|---|
| BDBM50295351 |
|---|
| n/a |
|---|
| Name | BDBM50295351 |
|---|
| Synonyms: | CHEMBL560452 | N-methyl-aloisine A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H19N3O |
|---|
| Mol. Mass. | 281.3523 |
|---|
| SMILES | CCCCc1c(-c2ccc(O)cc2)n(C)c2nccnc12 |
|---|
| Structure | 
|
|---|
Search and Browse
