Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein, liver |
---|
Ligand | BDBM28700 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_578554 (CHEMBL1052396) |
---|
Kd | 340±n/a nM |
---|
Citation | Chuang, S; Velkov, T; Horne, J; Wielens, J; Chalmers, DK; Porter, CJ; Scanlon, MJ Probing the fibrate binding specificity of rat liver fatty acid binding protein. J Med Chem52:5344-55 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, liver |
---|
Name: | Fatty acid-binding protein, liver |
Synonyms: | FABPL_RAT | Fabp1 | Fatty acid-binding protein, liver | Liver fatty acid binding protein (rat L-FABP) |
Type: | Protein |
Mol. Mass.: | 14274.39 |
Organism: | Rattus norvegicus (Rat) |
Description: | rat L-FABP |
Residue: | 127 |
Sequence: | MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIH
NEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVY
KRVSKRI
|
|
|
BDBM28700 |
---|
n/a |
---|
Name | BDBM28700 |
Synonyms: | 2-(4-(4-Chlorobenzoyl)phenoxy)-2-methylpropionic acid | 2-{4-[(4-chlorophenyl)carbonyl]phenoxy}-2-methylpropanoic acid | CHEMBL981 | FENOFIBRIC ACID | FIBRICOR | Fenofibrate | LF 153 | alpha-1081 | procetofenic acid |
Type | Small organic molecule |
Emp. Form. | C17H15ClO4 |
Mol. Mass. | 318.752 |
SMILES | CC(C)(Oc1ccc(cc1)C(=O)c1ccc(Cl)cc1)C(O)=O |
Structure |
|