Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetfMet-Leu-Phe receptor 1/2
LigandBDBM50295515
Substrate/Competitorn/a
Meas. Tech.ChEMBL_580004
EC50 32±n/a nM
Citation Cilibrizzi AQuinn MTKirpotina LNSchepetkin IAHolderness JYe RDRabiet MJBiancalani CCesari NGraziano AVergelli CPieretti SDal Piaz VGiovannoni MP 6-methyl-2,4-disubstituted pyridazin-3(2H)-ones: a novel class of small-molecule agonists for formyl peptide receptors. J Med Chem 52:5044-57 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
fMet-Leu-Phe receptor 1/2
Name:fMet-Leu-Phe receptor 1/2
Synonyms:Formyl peptide Receptor | formyl peptide receptor 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38456.14
Organism:Homo sapiens (Human)
Description:gi_4503779
Residue:350
Sequence:
METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50295515
n/a
NameBDBM50295515
Synonyms:CHEMBL560780 | N-(4-Iodophenyl)-2-[5-(3-methoxybenzyl)-3-methyl-6-oxo-6H-pyridazin-1-yl]-acetamide
TypeSmall organic molecule
Emp. Form.C21H20IN3O3
Mol. Mass.489.3063
SMILESCOc1cccc(Cc2cc(C)nn(CC(=O)Nc3ccc(I)cc3)c2=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: