| Reaction Details |
|---|
 | Report a problem with these data |
| Target | fMet-Leu-Phe receptor |
|---|
| Ligand | BDBM50295513 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_580004 (CHEMBL1051692) |
|---|
| EC50 | 500±n/a nM |
|---|
| Citation |  Cilibrizzi, A; Quinn, MT; Kirpotina, LN; Schepetkin, IA; Holderness, J; Ye, RD; Rabiet, MJ; Biancalani, C; Cesari, N; Graziano, A; Vergelli, C; Pieretti, S; Dal Piaz, V; Giovannoni, MP 6-methyl-2,4-disubstituted pyridazin-3(2H)-ones: a novel class of small-molecule agonists for formyl peptide receptors. J Med Chem52:5044-57 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| fMet-Leu-Phe receptor |
|---|
| Name: | fMet-Leu-Phe receptor |
|---|
| Synonyms: | FPR | FPR1 | FPR1_HUMAN | Formyl peptide Receptor | N-formyl peptide receptor 1 | N-formylpeptide chemoattractant receptor | fMLP receptor | fMet-Leu-Phe receptor | formyl peptide receptor 1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 38456.14 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_4503779 |
|---|
| Residue: | 350 |
|---|
| Sequence: | METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
|
|
|
|---|
| BDBM50295513 |
|---|
| n/a |
|---|
| Name | BDBM50295513 |
|---|
| Synonyms: | (S)-6-amino-2-((S)-2-amino-3-(1H-indol-3-yl)propanamido)-N-((5R,8S,11S,14S)-5-carbamoyl-15-(4-hydroxyphenyl)-8-isopropyl-11-(2-(methylthio)ethyl)-7,10,13-trioxo-2-thia-6,9,12-triazapentadecan-14-yl)hexanamide | CHEMBL552527 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C41H61N9O7S2 |
|---|
| Mol. Mass. | 856.109 |
|---|
| SMILES | CSCC[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(C)C)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
