Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanin-concentrating hormone receptor 1
LigandBDBM50295690
Substrate/Competitorn/a
Meas. Tech.ChEMBL_577918
Ki 0.5±n/a nM
Citation Ito MSakamoto TSuzuki TEgashira SMoriya MIshihara AIwaasa HMatsushita HNakase KWallace MADean DSato NTokita SKanatani A Identification and characterization of a selective radioligand for melanin-concentrating hormone 1-receptor (MCH1R). Bioorg Med Chem Lett 19:2835-9 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanin-concentrating hormone receptor 1
Name:Melanin-concentrating hormone receptor 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:46284.17
Organism:Mus musculus
Description:ChEMBL_818502
Residue:423
Sequence:
MSVGAGKEGVGRAVGLRGSRGCQAVEEDPFLDCGAQAPGQGGGGRWRLPQPAWVDGRALH
SREQATCTGCMDLQASLLSTGPNASNISDGQDNFTLAGPPPRTRSVSYINIIMPSVFGTI
CLLGIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWH
FGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSMATLVICLLWAL
SFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVK
ILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFV
YLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTES
KGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50295690
n/a
NameBDBM50295690
Synonyms:(+/-)-2-(3,4-difluorophenyl)-N-ethyl-N-(3-(6-fluoro-3H-spiro[isobenzofuran-1,4''-piperidine]-1''-yl)propyl)-2-(4-(methylsulfonyl)-2-oxopiperazin-1-yl)acetamide | 2-(3,4-difluorophenyl)-N-ethyl-N-(3-(6-fluoro-3H-spiro[isobenzofuran-1,4'-piperidine]-1'-yl)propyl)-2-(4-(methylsulfonyl)-2-oxopiperazin-1-yl)acetamide | CHEMBL538424 | CHEMBL538425
TypeSmall organic molecule
Emp. Form.C30H37F3N4O5S
Mol. Mass.622.699
SMILESCCN(CCCN1CCC2(CC1)OCc1ccc(F)cc21)C(=O)C(N1CCN(CC1=O)S(C)(=O)=O)c1ccc(F)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: