Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM50296848 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_582709 (CHEMBL1054971) |
---|
Ki | 28±n/a nM |
---|
Citation | Sandham, DA; Adcock, C; Bala, K; Barker, L; Brown, Z; Dubois, G; Budd, D; Cox, B; Fairhurst, RA; Furegati, M; Leblanc, C; Manini, J; Profit, R; Reilly, J; Stringer, R; Schmidt, A; Turner, KL; Watson, SJ; Willis, J; Williams, G; Wilson, C 7-Azaindole-3-acetic acid derivatives: potent and selective CRTh2 receptor antagonists. Bioorg Med Chem Lett19:4794-8 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD294 antigen | Crth2 | G protein-coupled receptor 44 | Gpr44 | PD2R2_MOUSE | Ptgdr2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 42975.89 |
Organism: | Mus musculus (mouse) |
Description: | Human embryonic kidney (HEK) 293(EBNA) cells were transfected with mouse CRTH2. |
Residue: | 382 |
Sequence: | MANVTLKPLCPLLEEMVQLPNHSNSSLRYIDHVSVLLHGLASLLGLVENGLILFVVGCRM
RQTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCKLHSSVFFLNMFASGFL
LSAISLDRCLQVVRPVWAQNHRTVAVAHRVCLMLWALAVLNTIPYFVFRDTIPRLDGRIM
CYYNLLLWNPGPDRDTTCDYRQKALAVSKFLLAFMVPLAIIASSHVAVSLRLHHRGRQRT
GRFVRLVAAIVVAFVLCWGPYHIFSLLEARAHSVTTLRQLASRGLPFVTSLAFFNSVVNP
LLYVFTCPDMLYKLRRSLRAVLESVLVEDSDQSGGLRNRRRRASSTATPASTLLLADRIP
QLRPTRLIGWMRRGSAEVPQRV
|
|
|
BDBM50296848 |
---|
n/a |
---|
Name | BDBM50296848 |
Synonyms: | 2-(1-(3,4-difluorophenylsulfonyl)-2-methyl-1H-pyrrolo[2,3-b]pyridin-3-yl)acetic acid | CHEMBL563949 |
Type | Small organic molecule |
Emp. Form. | C16H12F2N2O4S |
Mol. Mass. | 366.339 |
SMILES | Cc1c(CC(O)=O)c2cccnc2n1S(=O)(=O)c1ccc(F)c(F)c1 |
Structure |
|