Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50297331 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_583045 (CHEMBL1056544) |
---|
EC50 | 69±n/a nM |
---|
Citation | Le Bourdonnec, B; Windh, RT; Leister, LK; Zhou, QJ; Ajello, CW; Gu, M; Chu, GH; Tuthill, PA; Barker, WM; Koblish, M; Wiant, DD; Graczyk, TM; Belanger, S; Cassel, JA; Feschenko, MS; Brogdon, BL; Smith, SA; Derelanko, MJ; Kutz, S; Little, PJ; DeHaven, RN; DeHaven-Hudkins, DL; Dolle, RE Spirocyclic delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-3-hydroxy-4-(spiro[chromene-2,4'-piperidine]-4-yl) benzamide (ADL5747). J Med Chem52:5685-702 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50297331 |
---|
n/a |
---|
Name | BDBM50297331 |
Synonyms: | CHEMBL550472 | N,N-Diethyl-5-(spiro[chromene-2,4'-piperidine]-4-yl)thiophene-2-carboxamide |
Type | Small organic molecule |
Emp. Form. | C22H26N2O2S |
Mol. Mass. | 382.519 |
SMILES | CCN(CC)C(=O)c1ccc(s1)C1=CC2(CCNCC2)Oc2ccccc12 |t:13| |
Structure |
|