Reaction Details |
| Report a problem with these data |
Target | C-X-C chemokine receptor type 2 |
---|
Ligand | BDBM50297761 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_584049 (CHEMBL1055929) |
---|
Ki | 4±n/a nM |
---|
Citation | Aki, C; Chao, J; Ferreira, JA; Dwyer, MP; Yu, Y; Chao, J; Merritt, RJ; Lai, G; Wu, M; Hipkin, RW; Fan, X; Gonsiorek, W; Fosseta, J; Rindgen, D; Fine, J; Lundell, D; Taveras, AG; Biju, P Diaminocyclobutenediones as potent and orally bioavailable CXCR2 receptor antagonists: SAR in the phenolic amide region. Bioorg Med Chem Lett19:4446-9 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 2 |
---|
Name: | C-X-C chemokine receptor type 2 |
Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
Type: | Protein |
Mol. Mass.: | 40767.88 |
Organism: | Homo sapiens (Human) |
Description: | P25025 |
Residue: | 360 |
Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
BDBM50297761 |
---|
n/a |
---|
Name | BDBM50297761 |
Synonyms: | (R)-6-bromo-3-(3,4-dioxo-2-(1-phenylpropylamino)cyclobut-1-enylamino)-2-hydroxy-N,N-dimethylbenzamide | CHEMBL557466 |
Type | Small organic molecule |
Emp. Form. | C22H22BrN3O4 |
Mol. Mass. | 472.332 |
SMILES | CC[C@@H](Nc1c(Nc2ccc(Br)c(C(=O)N(C)C)c2O)c(=O)c1=O)c1ccccc1 |r| |
Structure |
|