Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 2
LigandBDBM50299615
Substrate/Competitorn/a
Meas. Tech.ChEMBL_592392
IC50 1.2±n/a nM
Citation Harrison BAWhitlock NAVoronkov MVAlmstead ZYGu KJMabon RGardyan MHamman BDAllen JGopinathan SMcKnight BCrist MZhang YLiu YCourtney LFKey BZhou JPatel NYates PWLiu QWilson AGKimball SDCrosson CERice DSRawlins DB Novel class of LIM-kinase 2 inhibitors for the treatment of ocular hypertension and associated glaucoma. J Med Chem 52:6515-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 2
Name:LIM domain kinase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:72238.81
Organism:Homo sapiens (Human)
Description:ChEMBL_1514398
Residue:638
Sequence:
MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNWYYEKDGKLYC
PKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQEQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPV
SQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPK
EPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSM
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEER
KRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEII
GQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDS
FEALSLYLGELGIPLPAELEELDHTVSMQYGLTRDSPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50299615
n/a
NameBDBM50299615
Synonyms:(S)-N'-cyano-N-(3-cyanophenyl)-2-methyl-4-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)piperazine-1-carboximidamide | CHEMBL569861
TypeSmall organic molecule
Emp. Form.C21H21N9
Mol. Mass.399.4517
SMILESC[C@H]1CN(CCN1C(NC#N)=Nc1cccc(c1)C#N)c1ncnc2[nH]cc(C)c12 |r,w:11.12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: