Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin D Synthase
LigandBDBM50300129
Substrate/Competitorn/a
Meas. Tech.ChEMBL_593692
IC50 2E2±n/a nM
Citation Weber JEOakley AJChrist ANClark AGHayes JDHall RHume DABoard PGSmythe MLFlanagan JU Identification and characterisation of new inhibitors for the human hematopoietic prostaglandin D2 synthase. Eur J Med Chem 45:447-54 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin D Synthase
Name:Prostaglandin D Synthase
Synonyms:Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | Prostaglandin D
Type:Enzyme
Mol. Mass.:23341.07
Organism:Homo sapiens (Human)
Description:The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag.
Residue:199
Sequence:
MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50300129
n/a
NameBDBM50300129
Synonyms:CHEMBL572528 | CIBACRON BLUE | Cibacron Blue 3Ga
TypeSmall organic molecule
Emp. Form.C29H20ClN7O11S3
Mol. Mass.774.157
SMILESNc1c(cc(Nc2ccc(Nc3nc(Cl)nc(Nc4ccccc4S(O)(=O)=O)n3)c(c2)S(O)(=O)=O)c2C(=O)c3ccccc3C(=O)c12)S(O)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: