Reaction Details |
| Report a problem with these data |
Target | Corticotropin-releasing factor receptor 1 |
---|
Ligand | BDBM50300148 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_593894 (CHEMBL1037787) |
---|
IC50 | 1.4±n/a nM |
---|
Citation | Hartz, RA; Ahuja, VT; Zhuo, X; Mattson, RJ; Denhart, DJ; Deskus, JA; Vrudhula, VM; Pan, S; Ditta, JL; Shu, YZ; Grace, JE; Lentz, KA; Lelas, S; Li, YW; Molski, TF; Krishnananthan, S; Wong, H; Qian-Cutrone, J; Schartman, R; Denton, R; Lodge, NJ; Zaczek, R; Macor, JE; Bronson, JJ A strategy to minimize reactive metabolite formation: discovery of (S)-4-(1-cyclopropyl-2-methoxyethyl)-6-[6-(difluoromethoxy)-2,5-dimethylpyridin-3-ylamino]-5-oxo-4,5-dihydropyrazine-2-carbonitrile as a potent, orally bioavailable corticotropin-releasing factor-1 receptor antagonist. J Med Chem52:7653-68 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Corticotropin-releasing factor receptor 1 |
---|
Name: | Corticotropin-releasing factor receptor 1 |
Synonyms: | CRF-R | CRF1 | CRFR1_RAT | CRH-R 1 | Corticotropin releasing factor receptor | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1 | Crhr | Crhr1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 47870.75 |
Organism: | Rattus norvegicus (rat) |
Description: | Receptor binding assays were performed using rat cortex homogenate. |
Residue: | 415 |
Sequence: | MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
|
|
|
BDBM50300148 |
---|
n/a |
---|
Name | BDBM50300148 |
Synonyms: | (R)-4-(1-Cyclopropyl-2-methoxyethyl)-6-[6-(difluoromethoxy)-2,5-dimethylpyridin-3-ylamino]-5-oxo-4,5-dihydropyrazine-2-carbonitrile | CHEMBL576589 |
Type | Small organic molecule |
Emp. Form. | C18H18ClF2N5O3 |
Mol. Mass. | 425.817 |
SMILES | COC[C@@H](C1CC1)n1cc(Cl)nc(Nc2cc(C#N)c(OC(F)F)nc2C)c1=O |r| |
Structure |
|