Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase ZAP-70
LigandBDBM4887
Substrate/Competitorn/a
Meas. Tech.ChEMBL_591751
IC50 25000±n/a nM
Citation Sanam RVadivelan STajne SNarasu LRambabu GJagarlapudi SA Discovery of potential ZAP-70 kinase inhibitors: pharmacophore design, database screening and docking studies. Eur J Med Chem 44:4793-800 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase ZAP-70
Name:Tyrosine-protein kinase ZAP-70
Synonyms:70 kDa zeta-associated protein | Syk-related tyrosine kinase | Tyrosine Kinase ZAP-70 | Tyrosine-protein kinase ZAP-70 | Tyrosine-protein kinase ZAP-70 (Syk) | Tyrosine-protein kinase ZAP-70 (ZAP70) | Tyrosine-protein kinase ZAP70 | Zeta-chain (TCR) associated protein kinase 70kDa
Type:Enzyme
Mol. Mass.:69881.61
Organism:Homo sapiens (Human)
Description:ZAP-70 SH2 domain was expressed and purified from E. coli using O-phospho-L-tyrosine-agarose column.
Residue:619
Sequence:
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
AQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARIT
SPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG
PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPY
KKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSL
ASKVEGPPGSTQKAEAACA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4887
n/a
NameBDBM4887
Synonyms:3-(4-methyl-5-{[(3Z)-2-oxo-2,3-dihydro-1H-indol-3-ylidene]methyl}-1H-pyrrol-3-yl)propanoic acid | 3-[4-Methyl-5-(2-oxo-1,2-dihydroindol-3-ylidenemethyl)-1H-pyrrol-3-yl]propionic Acid | 3-substituted indolin-2-one 11a | SU5402 analog 11a
TypeSmall organic molecule
Emp. Form.C17H16N2O3
Mol. Mass.296.3205
SMILESCc1c(CCC(O)=O)c[nH]c1\C=C1/C(=O)Nc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: