Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhodesain
LigandBDBM50268446
Substrate/Competitorn/a
Meas. Tech.ChEMBL_591545
IC50 500±n/a nM
Citation Mallari JPShelat AAKosinski ACaffrey CRConnelly MZhu FMcKerrow JHGuy RK Structure-guided development of selective TbcatB inhibitors. J Med Chem 52:6489-93 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Rhodesain
Name:Rhodesain
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:48425.78
Organism:Trypanosoma brucei rhodesiense
Description:ChEMBL_619861
Residue:450
Sequence:
MPRTEMVRFVRLPVVLLAMAACLASVALGSLHVEESLEMRFAAFKKKYGKVYKDAKEEAF
RFRAFEENMEQAKIQAAANPYATFGVTPFSDMTREEFRARYRNGASYFAAAQKRLRKTVN
VTTGRAPAAVDWREKGAVTPVKDQGQCGSCWAFSTIGNIEGQWQVAGNPLVSLSEQMLVS
CDTIDFGCGGGLMDNAFNWIVNSNGGNVFTEASYPYVSGNGEQPQCQMNGHEIGAAITDH
VDLPQDEDAIAAYLAENGPLAIAVDATSFMDYNGGILTSCTSEQLDHGVLLVGYNDSSNP
PYWIIKNSWSNMWGEDGYIRIEKGTNQCLMNQAVSSAVVGGPTPPPPPPPPPSATFTQDF
CEGKGCTKGCSHATFPTGECVQTTGVGSVIATCGASNLTQIIYPLSRSCSGLSVPITVPL
DKCIPILIGSVEYHCSTNPPTKAARLVPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50268446
n/a
NameBDBM50268446
Synonyms:CHEMBL496404 | methyl 3'-((2-cyano-9-(3-hydroxypropyl)-9H-purin-6-ylamino)methyl)biphenyl-3-carboxylate
TypeSmall organic molecule
Emp. Form.C24H22N6O3
Mol. Mass.442.4699
SMILESCOC(=O)c1cccc(c1)-c1cccc(CNc2nc(nc3n(CCCO)cnc23)C#N)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: