Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 Receptor
LigandBDBM50301098
Substrate/Competitorn/a
Meas. Tech.ChEMBL_598548
IC50>5000±n/a nM
Citation Ando MSekino EHaga YMoriya MIto MIto JIwaasa HIshihara AKanatani AOhtake N Discovery of novel phenethylpyridone derivatives as potent melanin-concentrating hormone 1 receptor antagonists. Bioorg Med Chem Lett 19:5186-90 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 Receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40115.31
Organism:Homo sapiens (Human)
Description:n/a
Residue:359
Sequence:
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50301098
n/a
NameBDBM50301098
Synonyms:4-(4-fluorobenzyloxy)-1-(2-(5-((propylamino)methyl)pyridin-2-yl)ethyl)pyridin-2(1H)-one | CHEMBL565833
TypeSmall organic molecule
Emp. Form.C23H26FN3O2
Mol. Mass.395.4698
SMILESCCCNCc1ccc(CCn2ccc(OCc3ccc(F)cc3)cc2=O)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: