Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransporter
LigandBDBM50198230
Substrate/Competitorn/a
Meas. Tech.ChEMBL_598777
Ki 0.84±n/a nM
Citation Jobson NKCrawford ARDewar DPimlott SLSutherland A Design and synthesis of (2R,3S)-iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. Bioorg Med Chem Lett 19:4996-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transporter
Name:Transporter
Synonyms:NET | Norepinephrine transporter(NET)
Type:Multi-pass membrane protein
Mol. Mass.:69236.90
Organism:Rattus norvegicus (rat)
Description:Q63380
Residue:617
Sequence:
MLLARMKPQVQPELGGADQLPEQPLRPCKTADLLVVKERNGVQCLLASQDGDAQPRETWG
KEIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQFN
REGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLNLPWTNCGHAW
NSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLC
LMVVIVVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFY
RLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFA
IFSILGYMAHEHKVKIEDVATEGAGLVFVLYPEAISTLSGSTFWAVLFFLMLLALGLDSS
MGGMEAVITGLADDFQVLKRHRKLFTCAVTLGTFLLAMFCITKGGIYVLTLLDTFAAGTS
ILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLLFVVVVSIINF
KPLTYDDYVYPPWANWVGWGIALSSMILVPAYVIYKFFSIRGSLWERVAYGITPENEHHL
VAQRDVRQFQLRHWLAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50198230
n/a
NameBDBM50198230
Synonyms:(S)-2-((S)-(2-iodophenoxy)(phenyl)methyl)morpholine | CHEMBL393236
TypeSmall organic molecule
Emp. Form.C17H18INO2
Mol. Mass.395.2348
SMILESIc1ccccc1O[C@H]([C@@H]1CNCCO1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: