Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-8 receptors, CXCR2
LigandBDBM50302098
Substrate/Competitorn/a
Meas. Tech.ChEMBL_599856
Ki 120±n/a nM
Citation Liu SLiu YWang HDing YWu HDong JWong AChen SHLi GChan MSawyer NGervais FGHenault MKargman SBedard LLHan YFriesen RLobell RBStout DM Design, synthesis, and evaluation of novel 3-amino-4-hydrazine-cyclobut-3-ene-1,2-diones as potent and selective CXCR2 chemokine receptor antagonists. Bioorg Med Chem Lett 19:5741-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-8 receptors, CXCR2
Name:Interleukin-8 receptors, CXCR1/CXCR2
Synonyms:C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | Interleukin-8 receptor B
Type:Protein
Mol. Mass.:40767.88
Organism:Homo sapiens (Human)
Description:P25025
Residue:360
Sequence:
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50302098
n/a
NameBDBM50302098
Synonyms:3-(2-(2,2-diethylhydrazinyl)-3,4-dioxocyclobut-1-enylamino)-2-hydroxy-N,N-dimethylbenzamide | CHEMBL577075
TypeSmall organic molecule
Emp. Form.C17H22N4O4
Mol. Mass.346.381
SMILESCCN(CC)Nc1c(Nc2cccc(C(=O)N(C)C)c2O)c(=O)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: