| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 1 |
|---|
| Ligand | BDBM50302104 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_599857 (CHEMBL1043640) |
|---|
| Ki | 5200±n/a nM |
|---|
| Citation |  Liu, S; Liu, Y; Wang, H; Ding, Y; Wu, H; Dong, J; Wong, A; Chen, SH; Li, G; Chan, M; Sawyer, N; Gervais, FG; Henault, M; Kargman, S; Bedard, LL; Han, Y; Friesen, R; Lobell, RB; Stout, DM Design, synthesis, and evaluation of novel 3-amino-4-hydrazine-cyclobut-3-ene-1,2-diones as potent and selective CXCR2 chemokine receptor antagonists. Bioorg Med Chem Lett19:5741-5 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 1 |
|---|
| Name: | C-X-C chemokine receptor type 1 |
|---|
| Synonyms: | C-X-C chemokine receptor type 1 (CXCR-1) | C-X-C chemokine receptor type 1 (CXCR1) | CMKAR1 | CXCR1 | CXCR1_HUMAN | IL8RA | Interleukin-8 receptor A | Interleukin-8 receptors, CXCR1/CXCR2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39803.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25024 |
|---|
| Residue: | 350 |
|---|
| Sequence: | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
|
|
|
|---|
| BDBM50302104 |
|---|
| n/a |
|---|
| Name | BDBM50302104 |
|---|
| Synonyms: | 3-(2-(2-ethyl-2-(pyridin-2-yl)hydrazinyl)-3,4-dioxocyclobut-1-enylamino)-2-hydroxy-N,N-dimethylbenzamide | CHEMBL585928 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H21N5O4 |
|---|
| Mol. Mass. | 395.4118 |
|---|
| SMILES | CCN(Nc1c(Nc2cccc(C(=O)N(C)C)c2O)c(=O)c1=O)c1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
