Reaction Details |
| Report a problem with these data |
Target | C-X-C chemokine receptor type 1 |
---|
Ligand | BDBM50302105 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_599857 (CHEMBL1043640) |
---|
Ki | >12000±n/a nM |
---|
Citation | Liu, S; Liu, Y; Wang, H; Ding, Y; Wu, H; Dong, J; Wong, A; Chen, SH; Li, G; Chan, M; Sawyer, N; Gervais, FG; Henault, M; Kargman, S; Bedard, LL; Han, Y; Friesen, R; Lobell, RB; Stout, DM Design, synthesis, and evaluation of novel 3-amino-4-hydrazine-cyclobut-3-ene-1,2-diones as potent and selective CXCR2 chemokine receptor antagonists. Bioorg Med Chem Lett19:5741-5 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 1 |
---|
Name: | C-X-C chemokine receptor type 1 |
Synonyms: | C-X-C chemokine receptor type 1 (CXCR-1) | C-X-C chemokine receptor type 1 (CXCR1) | CMKAR1 | CXCR1 | CXCR1_HUMAN | IL8RA | Interleukin-8 receptor A | Interleukin-8 receptors, CXCR1/CXCR2 |
Type: | Enzyme |
Mol. Mass.: | 39803.83 |
Organism: | Homo sapiens (Human) |
Description: | P25024 |
Residue: | 350 |
Sequence: | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
|
|
|
BDBM50302105 |
---|
n/a |
---|
Name | BDBM50302105 |
Synonyms: | 3-(2-(2-ethyl-2-(4-fluorobenzyl)hydrazinyl)-3,4-dioxocyclobut-1-enylamino)-2-hydroxy-N,N-dimethylbenzamide | CHEMBL569210 |
Type | Small organic molecule |
Emp. Form. | C22H23FN4O4 |
Mol. Mass. | 426.4408 |
SMILES | CCN(Cc1ccc(F)cc1)Nc1c(Nc2cccc(C(=O)N(C)C)c2O)c(=O)c1=O |
Structure |
|