Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E synthase
LigandBDBM50302429
Substrate/Competitorn/a
Meas. Tech.ChEMBL_597590
IC50 0.4±n/a nM
Citation Giroux ABoulet LBrideau CChau AClaveau DCôté BEthier DFrenette RGagnon MGuay JGuiral SMancini JMartins EMassé FMéthot NRiendeau DRubin JXu DYu HDucharme YFriesen RW Discovery of disubstituted phenanthrene imidazoles as potent, selective and orally active mPGES-1 inhibitors. Bioorg Med Chem Lett 19:5837-41 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E synthase
Name:Prostaglandin E synthase
Synonyms:Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E2 synthase-1 ( mPGES-1)
Type:Protein
Mol. Mass.:17112.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:152
Sequence:
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50302429
n/a
NameBDBM50302429
Synonyms:2-(9-(2-hydroxy-2-methylpropyl)-6-(isopentyloxy)-1H-phenanthro[9,10-d]imidazol-2-yl)isophthalonitrile | CHEMBL567696
TypeSmall organic molecule
Emp. Form.C32H30N4O2
Mol. Mass.502.6062
SMILESCC(C)CCOc1ccc2c3[nH]c(nc3c3ccc(CC(C)(C)O)cc3c2c1)-c1c(cccc1C#N)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: