| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50302764 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_595266 (CHEMBL1043618) |
|---|
| Ki | 1.4±n/a nM |
|---|
| Citation |  Jones, P; Griffin, AM; Gawell, L; Lavoie, R; Delorme, D; Roberts, E; Brown, W; Walpole, C; Xiao, W; Boulet, J; Labarre, M; Coupal, M; Butterworth, J; St-Onge, S; Hodzic, L; Salois, D N,N-Diethyl-4-[(3-hydroxyphenyl)(piperidin-4-yl)amino] benzamide derivatives: the development of diaryl amino piperidines as potent delta opioid receptor agonists with in vivo anti-nociceptive activity in rodent models. Bioorg Med Chem Lett19:5994-8 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50302764 |
|---|
| n/a |
|---|
| Name | BDBM50302764 |
|---|
| Synonyms: | CHEMBL568865 | N,N-diethyl-4-((3-hydroxyphenyl)(1-(2-phenylpropyl)piperidin-4-yl)amino)benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H39N3O2 |
|---|
| Mol. Mass. | 485.6603 |
|---|
| SMILES | CCN(CC)C(=O)c1ccc(cc1)N(C1CCN(CC(C)c2ccccc2)CC1)c1cccc(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
