| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kallikrein-4 |
|---|
| Ligand | BDBM50303420 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_595923 (CHEMBL1041781) |
|---|
| IC50 | 14454.4±n/a nM |
|---|
| Citation |  Mott, BT; Ferreira, RS; Simeonov, A; Jadhav, A; Ang, KK; Leister, W; Shen, M; Silveira, JT; Doyle, PS; Arkin, MR; McKerrow, JH; Inglese, J; Austin, CP; Thomas, CJ; Shoichet, BK; Maloney, DJ Identification and optimization of inhibitors of Trypanosomal cysteine proteases: cruzain, rhodesain, and TbCatB. J Med Chem53:52-60 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Kallikrein-4 |
|---|
| Name: | Kallikrein-4 |
|---|
| Synonyms: | EMSP1 | Enamel matrix serine proteinase 1 | KLK-L1 | KLK4 | KLK4_HUMAN | Kallikrein 4 | Kallikrein-4 | Kallikrein-like protein 1 | PRSS17 | PSTS | Prostase | Serine protease 17 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27022.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_595923 |
|---|
| Residue: | 254 |
|---|
| Sequence: | MATAGNPWGWFLGYLILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENELFCSGVL
VHPQWVLSAAHCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLI
KLDESVSESDTIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSK
LYDPLYHPSMFCAGGGHDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNL
CKFTEWIEKTVQAS
|
|
|
|---|
| BDBM50303420 |
|---|
| n/a |
|---|
| Name | BDBM50303420 |
|---|
| Synonyms: | 6-(3,5-Difluorophenylamino)-9-ethyl-9H-purine-2-carbonitrile | 6-[(3,5-difluorophenyl)amino]-9-ethyl-9H-purine-2-carbonitrile | CHEMBL567341 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H10F2N6 |
|---|
| Mol. Mass. | 300.2662 |
|---|
| SMILES | CCn1cnc2c(Nc3cc(F)cc(F)c3)nc(nc12)C#N |
|---|
| Structure | 
|
|---|
Search and Browse
