Reaction Details |
| Report a problem with these data |
Target | Kallikrein-4 |
---|
Ligand | BDBM50303436 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_595923 (CHEMBL1041781) |
---|
IC50 | 9772.37±n/a nM |
---|
Citation | Mott, BT; Ferreira, RS; Simeonov, A; Jadhav, A; Ang, KK; Leister, W; Shen, M; Silveira, JT; Doyle, PS; Arkin, MR; McKerrow, JH; Inglese, J; Austin, CP; Thomas, CJ; Shoichet, BK; Maloney, DJ Identification and optimization of inhibitors of Trypanosomal cysteine proteases: cruzain, rhodesain, and TbCatB. J Med Chem53:52-60 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Kallikrein-4 |
---|
Name: | Kallikrein-4 |
Synonyms: | EMSP1 | Enamel matrix serine proteinase 1 | KLK-L1 | KLK4 | KLK4_HUMAN | Kallikrein 4 | Kallikrein-4 | Kallikrein-like protein 1 | PRSS17 | PSTS | Prostase | Serine protease 17 |
Type: | PROTEIN |
Mol. Mass.: | 27022.83 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_595923 |
Residue: | 254 |
Sequence: | MATAGNPWGWFLGYLILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENELFCSGVL
VHPQWVLSAAHCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLI
KLDESVSESDTIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSK
LYDPLYHPSMFCAGGGHDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNL
CKFTEWIEKTVQAS
|
|
|
BDBM50303436 |
---|
n/a |
---|
Name | BDBM50303436 |
Synonyms: | 9-(2,2-difluoroethyl)-6-(3,5-difluorophenylamino)-9H-purine-2-carbonitrile | CHEMBL578159 |
Type | Small organic molecule |
Emp. Form. | C14H8F4N6 |
Mol. Mass. | 336.2471 |
SMILES | FC(F)Cn1cnc2c(Nc3cc(F)cc(F)c3)nc(nc12)C#N |
Structure |
|