| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Caspase-14 |
|---|
| Ligand | BDBM50303410 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_595880 (CHEMBL1040860) |
|---|
| IC50 | 14125.38±n/a nM |
|---|
| Citation |  Mott, BT; Ferreira, RS; Simeonov, A; Jadhav, A; Ang, KK; Leister, W; Shen, M; Silveira, JT; Doyle, PS; Arkin, MR; McKerrow, JH; Inglese, J; Austin, CP; Thomas, CJ; Shoichet, BK; Maloney, DJ Identification and optimization of inhibitors of Trypanosomal cysteine proteases: cruzain, rhodesain, and TbCatB. J Med Chem53:52-60 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Caspase-14 |
|---|
| Name: | Caspase-14 |
|---|
| Synonyms: | CASP14 | CASPE_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27674.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_595880 |
|---|
| Residue: | 242 |
|---|
| Sequence: | MSNPRSLEEEKYDMSGARLALILCVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQ
FQEELEKFQQAIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQAL
RAKPKVYIIQACRGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRH
DQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY
LQ
|
|
|
|---|
| BDBM50303410 |
|---|
| n/a |
|---|
| Name | BDBM50303410 |
|---|
| Synonyms: | 4-(3-chlorophenylamino)-6-(cyclopentylamino)-1,3,5-triazine-2-carbonitrile | CHEMBL567785 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H15ClN6 |
|---|
| Mol. Mass. | 314.773 |
|---|
| SMILES | Clc1cccc(Nc2nc(NC3CCCC3)nc(n2)C#N)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
