Reaction Details |
| Report a problem with these data |
Target | Caspase-14 |
---|
Ligand | BDBM50303417 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_595880 (CHEMBL1040860) |
---|
IC50 | 9120.11±n/a nM |
---|
Citation | Mott, BT; Ferreira, RS; Simeonov, A; Jadhav, A; Ang, KK; Leister, W; Shen, M; Silveira, JT; Doyle, PS; Arkin, MR; McKerrow, JH; Inglese, J; Austin, CP; Thomas, CJ; Shoichet, BK; Maloney, DJ Identification and optimization of inhibitors of Trypanosomal cysteine proteases: cruzain, rhodesain, and TbCatB. J Med Chem53:52-60 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Caspase-14 |
---|
Name: | Caspase-14 |
Synonyms: | CASP14 | CASPE_HUMAN |
Type: | PROTEIN |
Mol. Mass.: | 27674.68 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_595880 |
Residue: | 242 |
Sequence: | MSNPRSLEEEKYDMSGARLALILCVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQ
FQEELEKFQQAIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQAL
RAKPKVYIIQACRGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRH
DQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY
LQ
|
|
|
BDBM50303417 |
---|
n/a |
---|
Name | BDBM50303417 |
Synonyms: | 4-(Cyclopentylamino)-6-(3,5-difluorophenylamino)-1,3,5-triazine-2-carbonitrile | CHEMBL568171 |
Type | Small organic molecule |
Emp. Form. | C15H14F2N6 |
Mol. Mass. | 316.3087 |
SMILES | Fc1cc(F)cc(Nc2nc(NC3CCCC3)nc(n2)C#N)c1 |
Structure |
|