Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP3 Receptor
LigandBDBM50303661
Substrate/Competitorn/a
Meas. Tech.ChEMBL_596851
IC50 5±n/a nM
Citation Singh JZeller WZhou NHategan GMishra RKPolozov AYu POnua EZhang JRamírez JLSigthorsson GThorsteinnsdottir MKiselyov ASZembower DEAndrésson TGurney ME Structure-activity relationship studies leading to the identification of (2E)-3-[l-[(2,4-dichlorophenyl)methyl]-5-fluoro-3-methyl-lH-indol-7-yl]-N-[(4,5-dichloro-2-thienyl)sulfonyl]-2-propenamide (DG-041), a potent and selective prostanoid EP3 receptor antagonist, as a novel antiplatelet agent that J Med Chem 53:18-36 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid EP3 Receptor
Name:Prostanoid EP3 receptor
Synonyms:PGE receptor, EP3 isoform alpha | PTGER3 | Prostaglandin E2 receptor EP3 isoform alpha | Prostaglandin E3
Type:G-protein coupled receptor
Mol. Mass.:40092.50
Organism:Mus musculus (Mouse)
Description:n/a
Residue:365
Sequence:
MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMWS
DQLER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50303661
n/a
NameBDBM50303661
Synonyms:4,5-Dichlorothiophene-2-sulfonic Acid[(E)-3-(5-Fluoro-3-methyl-1-naphthalen-2-ylmethyl-1H-indol-7-yl)acryloyl]amide | CHEMBL565799
TypeSmall organic molecule
Emp. Form.C27H19Cl2FN2O3S2
Mol. Mass.573.486
SMILESCc1cn(Cc2ccc3ccccc3c2)c2c(\C=C\C(=O)NS(=O)(=O)c3cc(Cl)c(Cl)s3)cc(F)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: