Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP3 subtype |
---|
Ligand | BDBM50254473 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_596834 (CHEMBL1042645) |
---|
IC50 | 5±n/a nM |
---|
Citation | Singh, J; Zeller, W; Zhou, N; Hategan, G; Mishra, RK; Polozov, A; Yu, P; Onua, E; Zhang, J; Ramírez, JL; Sigthorsson, G; Thorsteinnsdottir, M; Kiselyov, AS; Zembower, DE; Andrésson, T; Gurney, ME Structure-activity relationship studies leading to the identification of (2E)-3-[l-[(2,4-dichlorophenyl)methyl]-5-fluoro-3-methyl-lH-indol-7-yl]-N-[(4,5-dichloro-2-thienyl)sulfonyl]-2-propenamide (DG-041), a potent and selective prostanoid EP3 receptor antagonist, as a novel antiplatelet agent that J Med Chem53:18-36 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP3 subtype |
---|
Name: | Prostaglandin E2 receptor EP3 subtype |
Synonyms: | PE2R3_HUMAN | PGE receptor, EP3 subtype | PGE2-R | PTGER3 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor |
Type: | Enzyme |
Mol. Mass.: | 43335.03 |
Organism: | Homo sapiens (Human) |
Description: | P43115 |
Residue: | 390 |
Sequence: | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
|
|
|
BDBM50254473 |
---|
n/a |
---|
Name | BDBM50254473 |
Synonyms: | 4,5-Dichlorothiophene-2-sulfonic Acid[2-(3-Naphthalen-2-ylmethyl-1H-indol-4-yloxy)acetyl]amide | CHEMBL467632 | N-(4,5-dichlorothiophen-2-ylsulfonyl)-2-(3-(naphthalen-2-ylmethyl)-1H-indol-4-yloxy)acetamide |
Type | Small organic molecule |
Emp. Form. | C25H18Cl2N2O4S2 |
Mol. Mass. | 545.457 |
SMILES | Clc1cc(sc1Cl)S(=O)(=O)NC(=O)COc1cccc2[nH]cc(Cc3ccc4ccccc4c3)c12 |
Structure |
|