Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProhormone convertase 2
LigandBDBM50303778
Substrate/Competitorn/a
Meas. Tech.ChEMBL_597568
Ki>10000±n/a nM
Citation Becker GLSielaff FThan MELindberg IRouthier SDay RLu YGarten WSteinmetzer T Potent inhibitors of furin and furin-like proprotein convertases containing decarboxylated P1 arginine mimetics. J Med Chem 53:1067-75 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prohormone convertase 2
Name:Prohormone convertase 2
Synonyms:KEX2-like endoprotease 2 | NEC 2 | Neuroendocrine convertase 2 | PC2 | Proprotein convertase 2
Type:PROTEIN
Mol. Mass.:70563.93
Organism:Homo sapiens (Human)
Description:ChEMBL_1290738
Residue:638
Sequence:
MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILNKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50303778
n/a
NameBDBM50303778
Synonyms:(S)-N-((1-carbamimidoylpiperidin-4-yl)methyl)-5-guanidino-2-((S)-2-((S)-5-guanidino-2-(2-phenylacetamido)pentanamido)-3-methylbutanamido)pentanamide | CHEMBL568067
TypeSmall organic molecule
Emp. Form.C32H55N13O4
Mol. Mass.685.8638
SMILES[#6]-[#6](-[#6])-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#7]-[#6](=O)-[#6]-c1ccccc1)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#6](=O)-[#7]-[#6]-[#6]-1-[#6]-[#6]-[#7](-[#6]-[#6]-1)-[#6](-[#7])=[#7] |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: